TOMM70A Blocking Peptide (33R-10431)

A synthetic peptide for use as a blocking control in assays to test for specificity of TOMM70A antibody, catalog no. 70R-10418

Synonyms TOMM70A control peptide, TOMM70A antibody Blocking Peptide, Anti-TOMM70A Blocking Peptide, translocase of outer mitochondrial membrane 70 homolog A, S. cerevisiae Blocking Peptide, FLJ90470 Blocking Peptide, TOMM70A, TOMMA-70, TOMMA 70, TOMMA-70 Blocking Peptide, TOMMA 70 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YLWSRQQRRREARGRGDASGLKRNSERKTPEGRASPAPGSGHPEGPGAHL
Molecular Weight 67 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The translocase of outer mitochondrial membrane (TOM) complex is a multisubunit complex involved in the recognition, unfolding, and translocation of preproteins into the mitochondria.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors