TPCN1 antibody (70R-5158)

Rabbit polyclonal TPCN1 antibody raised against the N terminal of TPCN1

Synonyms Polyclonal TPCN1 antibody, Anti-TPCN1 antibody, KIAA1169 antibody, TPCN1, TPCN 1 antibody, TPC1 antibody, Two Pore Segment Channel 1 antibody, TPCN-1, TPCN 1, TPCN-1 antibody, FLJ20612 antibody
Specificity TPCN1 antibody was raised against the N terminal of TPCN1
Cross Reactivity Human
Applications WB
Immunogen TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
Assay Information TPCN1 Blocking Peptide, catalog no. 33R-10210, is also available for use as a blocking control in assays to test for specificity of this TPCN1 antibody

Images

Western Blot analysis using TPCN1 antibody (70R-5158)

TPCN1 antibody (70R-5158) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 94 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPCN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TPCN1 antibody (70R-5158) | TPCN1 antibody (70R-5158) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors