TPD52 antibody (70R-3391)

Rabbit polyclonal TPD52 antibody raised against the middle region of TPD52

Synonyms Polyclonal TPD52 antibody, Anti-TPD52 antibody, PrLZ antibody, TPD-52 antibody, TPD52, hD52 antibody, TPD 52, D52 antibody, PC-1 antibody, Tumor Protein D52 antibody, TPD 52 antibody, TPD-52, N8L antibody
Specificity TPD52 antibody was raised against the middle region of TPD52
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TPD52 antibody was raised using the middle region of TPD52 corresponding to a region with amino acids AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG
Assay Information TPD52 Blocking Peptide, catalog no. 33R-1215, is also available for use as a blocking control in assays to test for specificity of this TPD52 antibody


Western Blot analysis using TPD52 antibody (70R-3391)

TPD52 antibody (70R-3391) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPD52 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPD52 belongs to the TPD52 family. Its exact function remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TPD52 antibody (70R-3391) | TPD52 antibody (70R-3391) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors