TPD52L3 antibody (70R-3437)

Rabbit polyclonal TPD52L3 antibody raised against the middle region of TPD52L3

Synonyms Polyclonal TPD52L3 antibody, Anti-TPD52L3 antibody, MGC45374 antibody, TPD-52 antibody, TPD-52, TPD 52 antibody, TPD 52, Tumor Protein D52-Like 3 antibody, MGC26757 antibody, NYD-SP25 antibody, TPD52, hD55 antibody
Specificity TPD52L3 antibody was raised against the middle region of TPD52L3
Cross Reactivity Human
Applications WB
Immunogen TPD52L3 antibody was raised using the middle region of TPD52L3 corresponding to a region with amino acids GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS
Assay Information TPD52L3 Blocking Peptide, catalog no. 33R-3418, is also available for use as a blocking control in assays to test for specificity of this TPD52L3 antibody


Western Blot analysis using TPD52L3 antibody (70R-3437)

TPD52L3 antibody (70R-3437) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPD52L3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPD52L3 encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TPD52L3 antibody (70R-3437) | TPD52L3 antibody (70R-3437) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors