TPPP3 antibody (70R-3841)

Rabbit polyclonal TPPP3 antibody raised against the N terminal of TPPP3

Synonyms Polyclonal TPPP3 antibody, Anti-TPPP3 antibody, Tubulin Polymerization-Promoting Protein Family Member 3 antibody, p25gamma antibody, TPPP 3, CGI-38 antibody, TPPP-3 antibody, TPPP-3, TPPP3, p20 antibody, TPPP 3 antibody
Specificity TPPP3 antibody was raised against the N terminal of TPPP3
Cross Reactivity Human
Applications WB
Immunogen TPPP3 antibody was raised using the N terminal of TPPP3 corresponding to a region with amino acids MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV
Assay Information TPPP3 Blocking Peptide, catalog no. 33R-5611, is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody


Western Blot analysis using TPPP3 antibody (70R-3841)

TPPP3 antibody (70R-3841) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPPP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TPPP3 antibody (70R-3841) | TPPP3 antibody (70R-3841) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors