TPRKB antibody (70R-4344)

Rabbit polyclonal TPRKB antibody raised against the middle region of TPRKB

Synonyms Polyclonal TPRKB antibody, Anti-TPRKB antibody, CGI-121 antibody, Tp53Rk Binding Protein antibody
Specificity TPRKB antibody was raised against the middle region of TPRKB
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TPRKB antibody was raised using the middle region of TPRKB corresponding to a region with amino acids EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS
Assay Information TPRKB Blocking Peptide, catalog no. 33R-2447, is also available for use as a blocking control in assays to test for specificity of this TPRKB antibody


Western Blot analysis using TPRKB antibody (70R-4344)

TPRKB antibody (70R-4344) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPRKB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TPRKB protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TPRKB antibody (70R-4344) | TPRKB antibody (70R-4344) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors