TPST2 antibody (70R-6948)

Rabbit polyclonal TPST2 antibody raised against the middle region of TPST2

Synonyms Polyclonal TPST2 antibody, Anti-TPST2 antibody, TPST-2 antibody, TPST-2, Tyrosylprotein Sulfotransferase 2 antibody, TPST 2, TPST2, TPST 2 antibody
Specificity TPST2 antibody was raised against the middle region of TPST2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TPST2 antibody was raised using the middle region of TPST2 corresponding to a region with amino acids KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL
Assay Information TPST2 Blocking Peptide, catalog no. 33R-4245, is also available for use as a blocking control in assays to test for specificity of this TPST2 antibody

Images

Western Blot analysis using TPST2 antibody (70R-6948)

TPST2 antibody (70R-6948) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPST2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TPST2 antibody (70R-6948) | TPST2 antibody (70R-6948) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors