TPTE antibody (70R-1630)

Rabbit polyclonal TPTE antibody raised against the C terminal of TPTE

Synonyms Polyclonal TPTE antibody, Anti-TPTE antibody, PTEN2 antibody, Transmembrane Phosphatase With Tensin Homology antibody
Specificity TPTE antibody was raised against the C terminal of TPTE
Cross Reactivity Human
Applications WB
Immunogen TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids MNESPDPTDLAGVIIELGPNDSPQTSEFKGATEEAPAKESVLARLSKFEV
Assay Information TPTE Blocking Peptide, catalog no. 33R-6243, is also available for use as a blocking control in assays to test for specificity of this TPTE antibody


Western Blot analysis using TPTE antibody (70R-1630)

TPTE antibody (70R-1630) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TPTE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TPTE antibody (70R-1630) | TPTE antibody (70R-1630) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors