TPTE antibody (70R-5655)

Rabbit polyclonal TPTE antibody raised against the middle region of TPTE

Synonyms Polyclonal TPTE antibody, Anti-TPTE antibody, PTEN2 antibody, Transmembrane Phosphatase With Tensin Homology antibody
Specificity TPTE antibody was raised against the middle region of TPTE
Cross Reactivity Human
Applications WB
Immunogen TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFST
Assay Information TPTE Blocking Peptide, catalog no. 33R-10091, is also available for use as a blocking control in assays to test for specificity of this TPTE antibody

Images

Western Blot analysis using TPTE antibody (70R-5655)

TPTE antibody (70R-5655) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TPTE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TPTE antibody (70R-5655) | TPTE antibody (70R-5655) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors