TRABD antibody (70R-3719)

Rabbit polyclonal TRABD antibody raised against the middle region of TRABD

Synonyms Polyclonal TRABD antibody, Anti-TRABD antibody, MGC110928 antibody, PP2447 antibody, Trab Domain Containing antibody, LP6054 antibody
Specificity TRABD antibody was raised against the middle region of TRABD
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRABD antibody was raised using the middle region of TRABD corresponding to a region with amino acids LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY
Assay Information TRABD Blocking Peptide, catalog no. 33R-4818, is also available for use as a blocking control in assays to test for specificity of this TRABD antibody


Western Blot analysis using TRABD antibody (70R-3719)

TRABD antibody (70R-3719) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRABD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TRABD protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRABD antibody (70R-3719) | TRABD antibody (70R-3719) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors