TRAF3IP3 antibody (70R-6634)

Rabbit polyclonal TRAF3IP3 antibody raised against the middle region of TRAF3IP3

Synonyms Polyclonal TRAF3IP3 antibody, Anti-TRAF3IP3 antibody, MGC117354 antibody, Traf3 Interacting Protein 3 antibody, TRAFIP-3 antibody, T3JAM antibody, TRAFIP 3, DJ434O14.3 antibody, FLJ44151 antibody, TRAFIP-3, TRAFIP 3 antibody, MGC163289 antibody, TRAF3IP3
Specificity TRAF3IP3 antibody was raised against the middle region of TRAF3IP3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRAF3IP3 antibody was raised using the middle region of TRAF3IP3 corresponding to a region with amino acids KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS
Assay Information TRAF3IP3 Blocking Peptide, catalog no. 33R-4606, is also available for use as a blocking control in assays to test for specificity of this TRAF3IP3 antibody

Images

Western Blot analysis using TRAF3IP3 antibody (70R-6634)

TRAF3IP3 antibody (70R-6634) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAF3IP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRAF3IP3 antibody (70R-6634) | TRAF3IP3 antibody (70R-6634) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors