TRAF7 antibody (70R-5931)

Rabbit polyclonal TRAF7 antibody raised against the N terminal of TRAF7

Synonyms Polyclonal TRAF7 antibody, Anti-TRAF7 antibody, TRAF-7, TRAF7, TRAF 7, TRAF-7 antibody, RFWD1 antibody, TRAF 7 antibody, RNF119 antibody, MGC7807 antibody, Tnf Receptor-Associated Factor 7 antibody, DKFZp586I021 antibody
Specificity TRAF7 antibody was raised against the N terminal of TRAF7
Cross Reactivity Human,Rat
Applications WB
Immunogen TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR
Assay Information TRAF7 Blocking Peptide, catalog no. 33R-3462, is also available for use as a blocking control in assays to test for specificity of this TRAF7 antibody

Images

Western Blot analysis using TRAF7 antibody (70R-5931)

TRAF7 antibody (70R-5931) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAF7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tumor necrosis factor (TNF) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRAF7 antibody (70R-5931) | TRAF7 antibody (70R-5931) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors