TRAM1L1 antibody (70R-7050)

Rabbit polyclonal TRAM1L1 antibody raised against the middle region of TRAM1L1

Synonyms Polyclonal TRAM1L1 antibody, Anti-TRAM1L1 antibody, TRAM1L1, Translocation Associated Membrane Protein 1-Like 1 antibody, TRAML 1, TRAML 1 antibody, TRAML-1, MGC26568 antibody, TRAML-1 antibody
Specificity TRAM1L1 antibody was raised against the middle region of TRAM1L1
Cross Reactivity Human
Applications WB
Immunogen TRAM1L1 antibody was raised using the middle region of TRAM1L1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL
Assay Information TRAM1L1 Blocking Peptide, catalog no. 33R-5552, is also available for use as a blocking control in assays to test for specificity of this TRAM1L1 antibody


Western Blot analysis using TRAM1L1 antibody (70R-7050)

TRAM1L1 antibody (70R-7050) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAM1L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRAM1L1 antibody (70R-7050) | TRAM1L1 antibody (70R-7050) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors