TRAM2 antibody (70R-6865)

Rabbit polyclonal TRAM2 antibody raised against the N terminal of TRAM2

Synonyms Polyclonal TRAM2 antibody, Anti-TRAM2 antibody, KIAA0057 antibody, TRAM-2 antibody, TRAM 2 antibody, TRAM 2, TRAM2, TRAM-2, Translocation Associated Membrane Protein 2 antibody
Specificity TRAM2 antibody was raised against the N terminal of TRAM2
Cross Reactivity Human,Mouse
Applications WB
Immunogen TRAM2 antibody was raised using the N terminal of TRAM2 corresponding to a region with amino acids MFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDLVTILFYIFITII
Assay Information TRAM2 Blocking Peptide, catalog no. 33R-5990, is also available for use as a blocking control in assays to test for specificity of this TRAM2 antibody

Images

Western Blot analysis using TRAM2 antibody (70R-6865)

TRAM2 antibody (70R-6865) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRAM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRAM2 antibody (70R-6865) | TRAM2 antibody (70R-6865) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors