Transglutaminase 3 antibody (70R-3925)

Rabbit polyclonal Transglutaminase 3 antibody

Synonyms Polyclonal Transglutaminase 3 antibody, Anti-Transglutaminase 3 antibody, Transglutaminase -3 antibody, Transglutaminase 3, MGC126249 antibody, Transglutaminase 3, TGM3 antibody, TGE antibody, Transglutaminase 3 antibody, Protein-Glutamine-Gamma-Glutamyltransferase E antibody, MGC126250 antibody, Transglutaminase -3
Cross Reactivity Human
Applications WB
Immunogen Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS
Assay Information Transglutaminase 3 Blocking Peptide, catalog no. 33R-5600, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 3 antibody


Western Blot analysis using Transglutaminase 3 antibody (70R-3925)

Transglutaminase 3 antibody (70R-3925) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Transglutaminase 3 antibody (70R-3925) | Transglutaminase 3 antibody (70R-3925) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors