Transglutaminase 4 antibody (70R-3924)

Rabbit polyclonal Transglutaminase 4 antibody

Synonyms Polyclonal Transglutaminase 4 antibody, Anti-Transglutaminase 4 antibody, Transglutaminase -4 antibody, TGM4 antibody, Transglutaminase 4, hTGP antibody, Transglutaminase -4, Transglutaminase 4, Transglutaminase 4 antibody, TGP antibody
Cross Reactivity Human
Applications WB
Immunogen Transglutaminase 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC
Assay Information Transglutaminase 4 Blocking Peptide, catalog no. 33R-4320, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 4 antibody


Western Blot analysis using Transglutaminase 4 antibody (70R-3924)

Transglutaminase 4 antibody (70R-3924) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGM4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Transglutaminase 4 antibody (70R-3924) | Transglutaminase 4 antibody (70R-3924) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors