TRIB3 antibody (70R-3572)

Rabbit polyclonal TRIB3 antibody

Synonyms Polyclonal TRIB3 antibody, Anti-TRIB3 antibody, TRB3 antibody, SINK antibody, SKIP3 antibody, TRIB 3 antibody, TRIB3, Tribbles Homolog 3 antibody, NIPK antibody, TRIB 3, TRIB-3, C20orf97 antibody, TRIB-3 antibody
Cross Reactivity Human
Applications WB
Immunogen TRIB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
Assay Information TRIB3 Blocking Peptide, catalog no. 33R-10278, is also available for use as a blocking control in assays to test for specificity of this TRIB3 antibody

Images

Western Blot analysis using TRIB3 antibody (70R-3572)

TRIB3 antibody (70R-3572) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRIB3 antibody (70R-3572) | TRIB3 antibody (70R-3572) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors