TRIM37 antibody (70R-2244)

Rabbit polyclonal TRIM37 antibody raised against the middle region of TRIM37

Synonyms Polyclonal TRIM37 antibody, Anti-TRIM37 antibody, TEF3 antibody, Tripartite Motif-Containing 37 antibody, TRIM-37, TRIM 37, TRIM 37 antibody, TRIM37, TRIM-37 antibody, POB1 antibody, KIAA0898 antibody, MUL antibody
Specificity TRIM37 antibody was raised against the middle region of TRIM37
Cross Reactivity Human
Applications WB
Immunogen TRIM37 antibody was raised using the middle region of TRIM37 corresponding to a region with amino acids GMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQ
Assay Information TRIM37 Blocking Peptide, catalog no. 33R-3441, is also available for use as a blocking control in assays to test for specificity of this TRIM37 antibody


Western Blot analysis using TRIM37 antibody (70R-2244)

TRIM37 antibody (70R-2244) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRIM37 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRIM37 antibody (70R-2244) | TRIM37 antibody (70R-2244) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors