TRIM59 antibody (70R-1779)

Rabbit polyclonal TRIM59 antibody raised against the middle region of TRIM59

Synonyms Polyclonal TRIM59 antibody, Anti-TRIM59 antibody, TRIM 59, Tripartite Motif-Containing 59 antibody, TRIM-59 antibody, MGC129860 antibody, TRIM59, MRF1 antibody, TRIM57 antibody, TRIM-59, MGC129861 antibody, TSBF1 antibody, RNF104 antibody, MGC26631 antibody, TRIM 59 antibody
Specificity TRIM59 antibody was raised against the middle region of TRIM59
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV
Assay Information TRIM59 Blocking Peptide, catalog no. 33R-4912, is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody


Immunohistochemical staining using TRIM59 antibody (70R-1779)

TRIM59 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TRIM59 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using TRIM59 antibody (70R-1779) | TRIM59 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using TRIM59 antibody (70R-1779) | TRIM59 antibody (70R-1779) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors