TRMT5 antibody (70R-2000)

Rabbit polyclonal TRMT5 antibody

Synonyms Polyclonal TRMT5 antibody, Anti-TRMT5 antibody, TRMT 5 antibody, TRM5 antibody, Trm5 tRNA Methyltransferase 5 Homolog antibody, MGC111453 antibody, TRMT5, KIAA1393 antibody, TRMT-5 antibody, TRMT-5, TRMT 5
Cross Reactivity Human
Applications WB
Immunogen TRMT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT
Assay Information TRMT5 Blocking Peptide, catalog no. 33R-2587, is also available for use as a blocking control in assays to test for specificity of this TRMT5 antibody

Images

Western Blot analysis using TRMT5 antibody (70R-2000)

TRMT5 antibody (70R-2000) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRMT5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRMT5 antibody (70R-2000) | TRMT5 antibody (70R-2000) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors