TRMU antibody (70R-2462)

Rabbit polyclonal TRMU antibody raised against the C terminal of TRMU

Synonyms Polyclonal TRMU antibody, Anti-TRMU antibody, MTU1 antibody, TRMT1 antibody, tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase antibody, TRNT1 antibody, MTO2 antibody, TRMT antibody, MGC99627 antibody
Specificity TRMU antibody was raised against the C terminal of TRMU
Cross Reactivity Human
Applications WB
Immunogen TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP
Assay Information TRMU Blocking Peptide, catalog no. 33R-1321, is also available for use as a blocking control in assays to test for specificity of this TRMU antibody


Western Blot analysis using TRMU antibody (70R-2462)

TRMU antibody (70R-2462) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRMU antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRMU antibody (70R-2462) | TRMU antibody (70R-2462) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors