Tropomodulin 3 antibody (70R-3615)

Rabbit polyclonal Tropomodulin 3 antibody

Synonyms Polyclonal Tropomodulin 3 antibody, Anti-Tropomodulin 3 antibody, Tropomodulin 3, Tropomodulin 3, Tropomodulin -3, Tropomodulin -3 antibody, TMOD3 antibody, Tropomodulin 3 antibody, UTMOD antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT
Assay Information Tropomodulin 3 Blocking Peptide, catalog no. 33R-4183, is also available for use as a blocking control in assays to test for specificity of this Tropomodulin 3 antibody

Images

Western Blot analysis using Tropomodulin 3 antibody (70R-3615)

Tropomodulin 3 antibody (70R-3615) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMOD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Tropomodulin 3 antibody (70R-3615) | Tropomodulin 3 antibody (70R-3615) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors