TRPC6 antibody (70R-5132)

Rabbit polyclonal TRPC6 antibody raised against the middle region of TRPC6

Synonyms Polyclonal TRPC6 antibody, Anti-TRPC6 antibody, TRPC-6, TRPC-6 antibody, TRPC6, FSGS2 antibody, TRPC 6, FLJ11098 antibody, Transient Receptor Potential Cation Channel Subfamily C Member 6 antibody, TRPC 6 antibody, FLJ14863 antibody, TRP6 antibody
Specificity TRPC6 antibody was raised against the middle region of TRPC6
Cross Reactivity Human
Applications WB
Immunogen TRPC6 antibody was raised using the middle region of TRPC6 corresponding to a region with amino acids KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE
Assay Information TRPC6 Blocking Peptide, catalog no. 33R-4464, is also available for use as a blocking control in assays to test for specificity of this TRPC6 antibody


Western Blot analysis using TRPC6 antibody (70R-5132)

TRPC6 antibody (70R-5132) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 106 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPC6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRPC6 antibody (70R-5132) | TRPC6 antibody (70R-5132) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors