TRPM2 antibody (70R-6526)

Rabbit polyclonal TRPM2 antibody raised against the N terminal of TRPM2

Synonyms Polyclonal TRPM2 antibody, Anti-TRPM2 antibody, NUDT9L1 antibody, TRPM-2, KNP3 antibody, TRPM2, TRPM 2 antibody, LTRPC2 antibody, NUDT9H antibody, MGC133383 antibody, Transient Receptor Potential Cation Channel Subfamily M Member 2 antibody, EREG1 antibody, TRPC7 antibody, TRPM-2 antibody, TRPM 2
Specificity TRPM2 antibody was raised against the N terminal of TRPM2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TRPM2 antibody was raised using the N terminal of TRPM2 corresponding to a region with amino acids VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
Assay Information TRPM2 Blocking Peptide, catalog no. 33R-9418, is also available for use as a blocking control in assays to test for specificity of this TRPM2 antibody

Images

Immunohistochemical staining using TRPM2 antibody (70R-6526)

TRPM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 171 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using TRPM2 antibody (70R-6526) | TRPM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using TRPM2 antibody (70R-6526) | Western Blot showing TRPM2 antibody used at a concentration of 1 ug/ml against Fetal Brain Lysate

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors