TRPM3 antibody (70R-1516)

Rabbit polyclonal TRPM3 antibody raised against the N terminal of TRPM3

Synonyms Polyclonal TRPM3 antibody, Anti-TRPM3 antibody, TRPM3, TRPM-3, Transient Receptor Potential Cation Channel Subfamily M Member 3 antibody, TRPM 3 antibody, TRPM 3, TRPM-3 antibody
Specificity TRPM3 antibody was raised against the N terminal of TRPM3
Cross Reactivity Human
Applications WB
Immunogen TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTY
Assay Information TRPM3 Blocking Peptide, catalog no. 33R-9228, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody

Images

Western Blot analysis using TRPM3 antibody (70R-1516)

TRPM3 antibody (70R-1516) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TRPM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of the TRPM3 gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by TRPM3 mediates calcium entry, and this entry is potentiated by calcium store depletion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRPM3 antibody (70R-1516) | TRPM3 antibody (70R-1516) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors