TRPM3 antibody (70R-5043)

Rabbit polyclonal TRPM3 antibody raised against the N terminal of TRPM3

Synonyms Polyclonal TRPM3 antibody, Anti-TRPM3 antibody, Transient Receptor Potential Cation Channel Subfamily M Member 3 antibody, TRPM-3 antibody, TRPM 3, TRPM-3, TRPM 3 antibody, TRPM3
Specificity TRPM3 antibody was raised against the N terminal of TRPM3
Cross Reactivity Human
Applications WB
Immunogen TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL
Assay Information TRPM3 Blocking Peptide, catalog no. 33R-8112, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody

Images

Western Blot analysis using TRPM3 antibody (70R-5043)

TRPM3 antibody (70R-5043) used at 2 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPM3 belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRPM3 antibody (70R-5043) | TRPM3 antibody (70R-5043) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors