TRPM5 Blocking Peptide (33R-1043)

A synthetic peptide for use as a blocking control in assays to test for specificity of TRPM5 antibody, catalog no. 70R-1542

Synonyms TRPM5 control peptide, TRPM5 antibody Blocking Peptide, Anti-TRPM5 Blocking Peptide, Transient Receptor Potential Cation Channel Subfamily M Member 5 Blocking Peptide, LTRPC5 Blocking Peptide, MTR1 Blocking Peptide, TRPM5, TRPM-5, TRPM 5, TRPM-5 Blocking Peptide, TRPM 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDI
Molecular Weight 131 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors