TRPM8 antibody (70R-5149)

Rabbit polyclonal TRPM8 antibody raised against the N terminal of TRPM8

Synonyms Polyclonal TRPM8 antibody, Anti-TRPM8 antibody, MGC2849 antibody, TRPM8, TRPM-8, TRPM 8 antibody, Transient Receptor Potential Cation Channel Subfamily M Member 8 antibody, TRPM 8, TRPP8 antibody, TRPM-8 antibody, LTRPC6 antibody
Specificity TRPM8 antibody was raised against the N terminal of TRPM8
Cross Reactivity Human
Applications WB
Immunogen TRPM8 antibody was raised using the N terminal of TRPM8 corresponding to a region with amino acids YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
Assay Information TRPM8 Blocking Peptide, catalog no. 33R-10139, is also available for use as a blocking control in assays to test for specificity of this TRPM8 antibody

Images

Western Blot analysis using TRPM8 antibody (70R-5149)

TRPM8 antibody (70R-5149) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 128 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPM8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPM8 is the receptor-activated non-selective cation channel involved in detection of sensations such as coolness, by being activated by cold temperature below 25 degrees Celsius. TRPM8 is activated by icilin, eucalyptol, menthol, cold and modulation of intracellular pH. TRPM8 is involved in menthol sensation. TRPM8 is permeable for monovalent cations sodium, potassium, and cesium and divalent cation calcium. Temperature sensing is tightly linked to voltage-dependent gating. TRPM8 was activated upon depolarization, changes in temperature resulting in graded shifts of its voltage-dependent activation curves. The chemical agonists menthol functions as a gating modifier, shifting activation curves towards physiological membrane potentials. Temperature sensitivity arises from a tenfold difference in the activation energies associated with voltage-dependent opening and closing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRPM8 antibody (70R-5149) | TRPM8 antibody (70R-5149) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors