TRPV4 antibody (70R-5169)

Rabbit polyclonal TRPV4 antibody raised against the middle region of TRPV4

Synonyms Polyclonal TRPV4 antibody, Anti-TRPV4 antibody, TRP12 antibody, VRL2 antibody, TRPV 4, VROAC antibody, Transient Receptor Potential Cation Channel Subfamily V Member 4 antibody, TRPV4, TRPV-4 antibody, VRL-2 antibody, TRPV 4 antibody, VR-OAC antibody, TRPV-4, OTRPC4 antibody
Specificity TRPV4 antibody was raised against the middle region of TRPV4
Cross Reactivity Human
Applications WB
Immunogen TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR
Assay Information TRPV4 Blocking Peptide, catalog no. 33R-8240, is also available for use as a blocking control in assays to test for specificity of this TRPV4 antibody

Images

Western Blot analysis using TRPV4 antibody (70R-5169)

TRPV4 antibody (70R-5169) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TRPV4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRPV4 is a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. TRPV4 is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TRPV4 antibody (70R-5169) | TRPV4 antibody (70R-5169) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors