TRSPAP1 antibody (70R-1414)

Rabbit polyclonal TRSPAP1 antibody raised against the middle region of TRSPAP1

Synonyms Polyclonal TRSPAP1 antibody, Anti-TRSPAP1 antibody, SECP43 antibody, RP4-669K10.4 antibody, tRNA Selenocysteine Associated Protein 1 antibody, FLJ20503 antibody, TRSPAP 1 antibody, TRSPAP-1 antibody, TRSPAP1, PRO1902 antibody, TRSPAP-1, TRSPAP 1
Specificity TRSPAP1 antibody was raised against the middle region of TRSPAP1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TRSPAP1 antibody was raised using the middle region of TRSPAP1 corresponding to a region with amino acids KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
Assay Information TRSPAP1 Blocking Peptide, catalog no. 33R-4598, is also available for use as a blocking control in assays to test for specificity of this TRSPAP1 antibody


Western Blot analysis using TRSPAP1 antibody (70R-1414)

TRSPAP1 antibody (70R-1414) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TRSPAP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TRSPAP1 is involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. It stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. It may be involved in the methylation of tRNA(Sec) and enhances efficiency of selenoproteins synthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TRSPAP1 antibody (70R-1414) | TRSPAP1 antibody (70R-1414) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors