TSGA13 antibody (70R-3278)

Rabbit polyclonal TSGA13 antibody raised against the middle region of TSGA13

Synonyms Polyclonal TSGA13 antibody, Anti-TSGA13 antibody, TSGA13, Testis Specific 13 antibody, TSGA 13, TSGA-13, TSGA 13 antibody, TSGA-13 antibody
Specificity TSGA13 antibody was raised against the middle region of TSGA13
Cross Reactivity Human
Applications WB
Immunogen TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
Assay Information TSGA13 Blocking Peptide, catalog no. 33R-1503, is also available for use as a blocking control in assays to test for specificity of this TSGA13 antibody

Images

Western Blot analysis using TSGA13 antibody (70R-3278)

TSGA13 antibody (70R-3278) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSGA13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of TSGA13 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TSGA13 antibody (70R-3278) | TSGA13 antibody (70R-3278) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors