TSHR antibody (70R-1187)

Rabbit polyclonal TSHR antibody raised against the N terminal of TSHR

Synonyms Polyclonal TSHR antibody, Anti-TSHR antibody, LGR3 antibody, Thyroid Stimulating Hormone Receptor antibody, hTSHR-I antibody, MGC75129 antibody
Specificity TSHR antibody was raised against the N terminal of TSHR
Cross Reactivity Human
Applications WB
Immunogen TSHR antibody was raised using the N terminal of TSHR corresponding to a region with amino acids CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR
Assay Information TSHR Blocking Peptide, catalog no. 33R-1711, is also available for use as a blocking control in assays to test for specificity of this TSHR antibody

Images

Western Blot analysis using TSHR antibody (70R-1187)

TSHR antibody (70R-1187) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TSHR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSHR is receptor for thyrothropin. It plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. It also acts as a receptor for thyrostimulin (GPA2+GPB5).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TSHR antibody (70R-1187) | TSHR antibody (70R-1187) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $315.00
Size: 100 ug
OR
Shipping
View Our Distributors