TSPYL4 antibody (70R-3191)

Rabbit polyclonal TSPYL4 antibody raised against the middle region of TSPYL4

Synonyms Polyclonal TSPYL4 antibody, Anti-TSPYL4 antibody, TSPYL 4 antibody, TSPYL4, TSPYL-4, 2Tspy-Like 4 antibody, KIAA0721 antibody, Testis-Specific Y-encoded-like protein 4 antibody, TSPYL 4, dJ486I3.2 antibody, TSPYL-4 antibody
Specificity TSPYL4 antibody was raised against the middle region of TSPYL4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TSPYL4 antibody was raised using the middle region of TSPYL4 corresponding to a region with amino acids QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE
Assay Information TSPYL4 Blocking Peptide, catalog no. 33R-7599, is also available for use as a blocking control in assays to test for specificity of this TSPYL4 antibody


Western Blot analysis using TSPYL4 antibody (70R-3191)

TSPYL4 antibody (70R-3191) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPYL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TSPYL4 belongs to the nucleosome assembly protein (NAP) family. The functions of TSPYL4 remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TSPYL4 antibody (70R-3191) | TSPYL4 antibody (70R-3191) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors