TST antibody (70R-2439)

Rabbit polyclonal TST antibody

Synonyms Polyclonal TST antibody, Anti-TST antibody, Thiosulfate Sulfurtransferase antibody, RDS antibody, MGC19578 antibody, Rhodanese antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP
Assay Information TST Blocking Peptide, catalog no. 33R-3229, is also available for use as a blocking control in assays to test for specificity of this TST antibody

Images

Western Blot analysis using TST antibody (70R-2439)

TST antibody (70R-2439) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TST antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TST antibody (70R-2439) | TST antibody (70R-2439) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using TST antibody (70R-2439) | TST antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors