TSTA3 antibody (70R-6048)

Rabbit polyclonal TSTA3 antibody raised against the N terminal of TSTA3

Synonyms Polyclonal TSTA3 antibody, Anti-TSTA3 antibody, TSTA3, FX antibody, TSTA-3, TSTA 3 antibody, TSTA 3, Tissue Specific Transplantation Antigen P35B antibody, TSTA-3 antibody, P35B antibody
Specificity TSTA3 antibody was raised against the N terminal of TSTA3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
Assay Information TSTA3 Blocking Peptide, catalog no. 33R-6023, is also available for use as a blocking control in assays to test for specificity of this TSTA3 antibody

Images

Western Blot analysis using TSTA3 antibody (70R-6048)

TSTA3 antibody (70R-6048) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSTA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tissue specific transplantation antigen P35B is a NADP(H)-binding protein. It catalyze the two-step epimerase and the reductase reactions in GDP-D-mannose metabolism, converting GDP-4-keto-6-D-deoxymannose to GDP-L-fucose. GDP-L-fucose is the substrate of several fucosyltransferases involved in the expression of many glycoconjugates, including blood group ABH antigens and developmental adhesion antigens. Mutations in this gene may cause leukocyte adhesion deficiency, type II.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TSTA3 antibody (70R-6048) | TSTA3 antibody (70R-6048) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors