TTC12 antibody (70R-3356)

Rabbit polyclonal TTC12 antibody raised against the C terminal of TTC12

Synonyms Polyclonal TTC12 antibody, Anti-TTC12 antibody, FLJ20535 antibody, TTC-12, TPARM antibody, TTC 12, TTC 12 antibody, TTC12, TTC-12 antibody, Tetratricopeptide Repeat Domain 12 antibody, FLJ13859 antibody
Specificity TTC12 antibody was raised against the C terminal of TTC12
Cross Reactivity Human,Rat
Applications WB
Immunogen TTC12 antibody was raised using the C terminal of TTC12 corresponding to a region with amino acids MNLCLQAPFVSEVWAVEVSRRCLSLLNSQDGGILTRAAGVLSRTLSSSLK
Assay Information TTC12 Blocking Peptide, catalog no. 33R-6251, is also available for use as a blocking control in assays to test for specificity of this TTC12 antibody


Western Blot analysis using TTC12 antibody (70R-3356)

TTC12 antibody (70R-3356) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTC12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TTC12 contains 3 TPR repeats. Hypermethylation of TTC12 gene may play a role in acute lymphoblastic leukemia. Haplotypic variants in DRD2, ANKK1, TTC12, and NCAM1 are associated with comorbid alcohol and drug dependence.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TTC12 antibody (70R-3356) | TTC12 antibody (70R-3356) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors