TTC14 antibody (70R-4867)

Rabbit polyclonal TTC14 antibody raised against the N terminal of TTC14

Synonyms Polyclonal TTC14 antibody, Anti-TTC14 antibody, Tetratricopeptide Repeat Domain 14 antibody, PRO19630 antibody, KIAA1980 antibody, TTC-14 antibody, TTC14, FLJ00166 antibody, TTC 14, DKFZp313M1015 antibody, TTC 14 antibody, DRDL5813 antibody, TTC-14
Specificity TTC14 antibody was raised against the N terminal of TTC14
Cross Reactivity Human
Applications WB
Immunogen TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK
Assay Information TTC14 Blocking Peptide, catalog no. 33R-5194, is also available for use as a blocking control in assays to test for specificity of this TTC14 antibody


Western Blot analysis using TTC14 antibody (70R-4867)

TTC14 antibody (70R-4867) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTC14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TTC14 belongs to the TTC14 family and contains 1 S1 motif domain and 4 TPR repeats. The functions of TTC14 remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TTC14 antibody (70R-4867) | TTC14 antibody (70R-4867) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors