TTMB antibody (70R-6812)

Rabbit polyclonal TTMB antibody raised against the N terminal Of Ttmb

Synonyms Polyclonal TTMB antibody, Anti-TTMB antibody, Transmembrane protein 200B antibody, MGC102864 antibody, MGC90489 antibody
Specificity TTMB antibody was raised against the N terminal Of Ttmb
Cross Reactivity Human
Applications WB
Immunogen TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI
Assay Information TTMB Blocking Peptide, catalog no. 33R-1238, is also available for use as a blocking control in assays to test for specificity of this TTMB antibody

Images

Western Blot analysis using TTMB antibody (70R-6812)

TTMB antibody (70R-6812) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTMB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TTMB is a multi-pass membrane protein. It belongs to the TMEM200 family. The function of the TTMB protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TTMB antibody (70R-6812) | TTMB antibody (70R-6812) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors