TTYH1 antibody (70R-6815)

Rabbit polyclonal TTYH1 antibody

Synonyms Polyclonal TTYH1 antibody, Anti-TTYH1 antibody, TTYH 1, TTYH-1, TTYH 1 antibody, TTYH-1 antibody, TTYH1, Tweety Homolog 1 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TTYH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA
Assay Information TTYH1 Blocking Peptide, catalog no. 33R-3168, is also available for use as a blocking control in assays to test for specificity of this TTYH1 antibody

Images

Western Blot analysis using TTYH1 antibody (70R-6815)

TTYH1 antibody (70R-6815) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TTYH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TTYH1 antibody (70R-6815) | TTYH1 antibody (70R-6815) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors