TWF1 antibody (70R-3895)

Rabbit polyclonal TWF1 antibody

Synonyms Polyclonal TWF1 antibody, Anti-TWF1 antibody, PTK9 antibody, MGC41876 antibody, TWF-1 antibody, MGC23788 antibody, Twinfilin Actin-Binding Protein Homolog 1 antibody, TWF-1, A6 antibody, TWF 1, TWF 1 antibody, TWF1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TWF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWD
Assay Information TWF1 Blocking Peptide, catalog no. 33R-6441, is also available for use as a blocking control in assays to test for specificity of this TWF1 antibody


Western Blot analysis using TWF1 antibody (70R-3895)

TWF1 antibody (70R-3895) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TWF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes twinfilin, an actin monomer-binding protein conserved from yeast to mammals. Studies of the mouse counterpart suggest that this protein may be an actin monomer-binding protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TWF1 antibody (70R-3895) | TWF1 antibody (70R-3895) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors