TXNDC14 antibody (70R-7407)

Rabbit polyclonal TXNDC14 antibody raised against the middle region of TXNDC14

Synonyms Polyclonal TXNDC14 antibody, Anti-TXNDC14 antibody, PIG26 antibody, Thioredoxin Domain Containing 14 antibody, TXNDC-14, TXNDC 14, TXNDC 14 antibody, MGC111151 antibody, TXNDC14, DKFZp781O2021 antibody, TMX2 antibody, CGI-31 antibody, TXNDC-14 antibody
Specificity TXNDC14 antibody was raised against the middle region of TXNDC14
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TXNDC14 antibody was raised using the middle region of TXNDC14 corresponding to a region with amino acids IRMGLLYITLCIVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWI
Assay Information TXNDC14 Blocking Peptide, catalog no. 33R-4138, is also available for use as a blocking control in assays to test for specificity of this TXNDC14 antibody

Images

Western Blot analysis using TXNDC14 antibody (70R-7407)

TXNDC14 antibody (70R-7407) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TXNDC14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TXNDC14 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TXNDC14 antibody (70R-7407) | TXNDC14 antibody (70R-7407) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors