TXNDC15 antibody (70R-7440)

Rabbit polyclonal TXNDC15 antibody raised against the C terminal of TXNDC15

Synonyms Polyclonal TXNDC15 antibody, Anti-TXNDC15 antibody, TXNDC-15 antibody, FLJ22625 antibody, TXNDC 15 antibody, C5orf14 antibody, TXNDC-15, TXNDC15, UNQ335 antibody, TXNDC 15, Thioredoxin Domain Containing 15 antibody
Specificity TXNDC15 antibody was raised against the C terminal of TXNDC15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV
Assay Information TXNDC15 Blocking Peptide, catalog no. 33R-8886, is also available for use as a blocking control in assays to test for specificity of this TXNDC15 antibody

Images

Western Blot analysis using TXNDC15 antibody (70R-7440)

TXNDC15 antibody (70R-7440) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TXNDC15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TXNDC15 is a single-pass type I membrane protein. It contains 1 thioredoxin domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TXNDC15 antibody (70R-7440) | TXNDC15 antibody (70R-7440) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors