TXNDC16 antibody (70R-6985)

Rabbit polyclonal TXNDC16 antibody raised against the N terminal of TXNDC16

Synonyms Polyclonal TXNDC16 antibody, Anti-TXNDC16 antibody, TXNDC 16, TXNDC-16, TXNDC 16 antibody, TXNDC16, KIAA1344 antibody, Thioredoxin Domain Containing 16 antibody, TXNDC-16 antibody
Specificity TXNDC16 antibody was raised against the N terminal of TXNDC16
Cross Reactivity Human,Mouse
Applications WB
Immunogen TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV
Assay Information TXNDC16 Blocking Peptide, catalog no. 33R-2774, is also available for use as a blocking control in assays to test for specificity of this TXNDC16 antibody

Images

Western Blot analysis using TXNDC16 antibody (70R-6985)

TXNDC16 antibody (70R-6985) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TXNDC16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TXNDC16 contains 1 thioredoxin domain. The exact function of TXNDC16 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TXNDC16 antibody (70R-6985) | TXNDC16 antibody (70R-6985) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors