TXNDC4 antibody (70R-3581)

Rabbit polyclonal TXNDC4 antibody

Synonyms Polyclonal TXNDC4 antibody, Anti-TXNDC4 antibody, TXNDC4, ERP44 antibody, TXNDC-4 antibody, TXNDC 4 antibody, TXNDC 4, KIAA0573 antibody, TXNDC-4, Thioredoxin Domain Containing 4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TXNDC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDE
Assay Information TXNDC4 Blocking Peptide, catalog no. 33R-5025, is also available for use as a blocking control in assays to test for specificity of this TXNDC4 antibody


Western Blot analysis using TXNDC4 antibody (70R-3581)

TXNDC4 antibody (70R-3581) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TXNDC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TXNDC4 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. TXNDC4 inhibits the calcium channel activity of ITPR1. TXNDC4 may have a role in the control of oxidative protein folding in the endoplasmic reticulum. TXNDC4 is required to retain ERO1L and ERO1LB in the endoplasmic reticulum.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TXNDC4 antibody (70R-3581) | TXNDC4 antibody (70R-3581) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors