TXNIP antibody (70R-2031)

Rabbit polyclonal TXNIP antibody raised against the C terminal of TXNIP

Synonyms Polyclonal TXNIP antibody, Anti-TXNIP antibody, VDUP1 antibody, THIF antibody, EST01027 antibody, HHCPA78 antibody, Thioredoxin Interacting Protein antibody
Specificity TXNIP antibody was raised against the C terminal of TXNIP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP
Assay Information TXNIP Blocking Peptide, catalog no. 33R-2201, is also available for use as a blocking control in assays to test for specificity of this TXNIP antibody


Western blot analysis using TXNIP antibody (70R-2031)

Recommended TXNIP Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TXNIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using TXNIP antibody (70R-2031) | Recommended TXNIP Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using TXNIP antibody (70R-2031) | Tissue analyzed: Human Fetal Lung; Antibody Dilution: 1.0ug/ml
  • Western blot analysis using TXNIP antibody (70R-2031) | Tissue analyzed: Human Adult Placenta; Antibody Dilution: 1.0ug/ml

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors