U2AF1 antibody (70R-4817)

Rabbit polyclonal U2AF1 antibody raised against the N terminal of U2AF1

Synonyms Polyclonal U2AF1 antibody, Anti-U2AF1 antibody, U2AF35 antibody, UAF1 2, RNU2AF1 antibody, U2 Small Nuclear Rna Auxiliary Factor 1 antibody, UAF1-2, U2AFBP antibody, U2AF1, RN antibody, UAF1 2 antibody, UAF1-2 antibody, FP793 antibody, DKFZp313J1712 antibody
Specificity U2AF1 antibody was raised against the N terminal of U2AF1
Cross Reactivity Human,Mouse,Rat,Drosophila
Applications WB
Immunogen U2AF1 antibody was raised using the N terminal of U2AF1 corresponding to a region with amino acids MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTILIQN
Assay Information U2AF1 Blocking Peptide, catalog no. 33R-5649, is also available for use as a blocking control in assays to test for specificity of this U2AF1 antibody


Western Blot analysis using U2AF1 antibody (70R-4817)

U2AF1 antibody (70R-4817) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of U2AF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using U2AF1 antibody (70R-4817) | U2AF1 antibody (70R-4817) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors