UBAC2 antibody (70R-6989)

Rabbit polyclonal UBAC2 antibody raised against the middle region of UBAC2

Synonyms Polyclonal UBAC2 antibody, Anti-UBAC2 antibody, FLJ42413 antibody, PHGDHL1 antibody, FLJ26351 antibody, UBAC-2, UBAC 2 antibody, MGC90487 antibody, UBAC2, UBAC-2 antibody, UBAC 2, Uba Domain Containing 2 antibody, FLJ30548 antibody, FLJ30001 antibody
Specificity UBAC2 antibody was raised against the middle region of UBAC2
Cross Reactivity Human,Mouse
Applications WB
Immunogen UBAC2 antibody was raised using the middle region of UBAC2 corresponding to a region with amino acids YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL
Assay Information UBAC2 Blocking Peptide, catalog no. 33R-10061, is also available for use as a blocking control in assays to test for specificity of this UBAC2 antibody

Images

Western Blot analysis using UBAC2 antibody (70R-6989)

UBAC2 antibody (70R-6989) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBAC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of UBAC2 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UBAC2 antibody (70R-6989) | UBAC2 antibody (70R-6989) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors