UBE2O antibody (70R-3984)

Rabbit polyclonal UBE2O antibody raised against the middle region of UBE2O

Synonyms Polyclonal UBE2O antibody, Anti-UBE2O antibody, UBEO 2, UBEO 2 antibody, UBEO-2 antibody, Ubiquitin-Conjugating Enzyme E2O antibody, KIAA1734 antibody, UBEO-2, UBE2O, E2-230K antibody, FLJ12878 antibody
Specificity UBE2O antibody was raised against the middle region of UBE2O
Cross Reactivity Human
Applications WB
Immunogen UBE2O antibody was raised using the middle region of UBE2O corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR
Assay Information UBE2O Blocking Peptide, catalog no. 33R-10192, is also available for use as a blocking control in assays to test for specificity of this UBE2O antibody

Images

Western Blot analysis using UBE2O antibody (70R-3984)

UBE2O antibody (70R-3984) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE2O antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UBE2O antibody (70R-3984) | UBE2O antibody (70R-3984) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors