Ubiquilin 4 antibody (70R-3308)

Rabbit polyclonal Ubiquilin 4 antibody raised against the middle region of UBQLN4

Synonyms Polyclonal Ubiquilin 4 antibody, Anti-Ubiquilin 4 antibody, Ubiquilin -4 antibody, C1orf6 antibody, Ubiquilin 4 antibody, Ubiquilin 4, Ubiquilin 4, UBIN antibody, UBQLN4 antibody, A1U antibody, Ubiquilin -4
Specificity Ubiquilin 4 antibody was raised against the middle region of UBQLN4
Cross Reactivity Human
Applications WB
Immunogen Ubiquilin 4 antibody was raised using the middle region of UBQLN4 corresponding to a region with amino acids TDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPS
Assay Information Ubiquilin 4 Blocking Peptide, catalog no. 33R-9011, is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 4 antibody


Western Blot analysis using Ubiquilin 4 antibody (70R-3308)

Ubiquilin 4 antibody (70R-3308) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBQLN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Ubiquilin 4 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Ubiquilin 4 antibody (70R-3308) | Ubiquilin 4 antibody (70R-3308) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors