Ubiquitin D antibody (70R-5744)

Rabbit polyclonal Ubiquitin D antibody raised against the N terminal of UBD

Synonyms Polyclonal Ubiquitin D antibody, Anti-Ubiquitin D antibody, UBD-3 antibody, UBD antibody, FAT10 antibody
Specificity Ubiquitin D antibody was raised against the N terminal of UBD
Cross Reactivity Human
Applications WB
Immunogen Ubiquitin D antibody was raised using the N terminal of UBD corresponding to a region with amino acids RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE
Assay Information Ubiquitin D Blocking Peptide, catalog no. 33R-8192, is also available for use as a blocking control in assays to test for specificity of this Ubiquitin D antibody

Images

Western Blot analysis using Ubiquitin D antibody (70R-5744)

Ubiquitin D antibody (70R-5744) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UBD qualifies as a marker for an interferon response in hepatocellular carcinoma and colon carcinoma but is not significantly overexpressed in cancers lacking a proinflammatory environment. Immunohistochemical studies demonstrated increased UBD expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Ubiquitin D antibody (70R-5744) | Ubiquitin D antibody (70R-5744) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors